PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA09G0142900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 246aa    MW: 26844.4 Da    PI: 10.6209
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA09G0142900.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.91.9e-17122168450
                        XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                        ++r rr++kNRe+A rsR+RK+a++ +Le++v++L++eNk+L+ + e
  ORGLA09G0142900.1 122 DRRKRRMIKNRESAARSRARKQARVNNLETEVEQLKQENKMLRVKYE 168
                        789***************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-14119183IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.0E-16121169No hitNo description
PROSITE profilePS5021711.277121170IPR004827Basic-leucine zipper domain
PfamPF001701.1E-15122169IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.56E-12123177No hitNo description
CDDcd147071.55E-19123169No hitNo description
PROSITE patternPS000360126141IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEDDEDMWAN TSSPSASPPR PRGFISTALS LNSTHLQGLL PSSFVDAAAS PCHASGNNNG  60
GGDGRNAAPM SSIFSASASY HQQQHHLPAP APLDGAILPA RRFGLDMCAA AAAPAGVPAA  120
GDRRKRRMIK NRESAARSRA RKQARVNNLE TEVEQLKQEN KMLRVKYEQV IHPWMQLARP  180
SSIPIDRSAC CCCCSITDNF ASASPPRFDS SRRRRQLRKT VEVPVPVRRT LQRGHSGQWL  240
EKPSLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126170.0CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611345.12e-90PREDICTED: uncharacterized protein LOC9271661
TrEMBLI1QQV00.0I1QQV0_ORYGL; Uncharacterized protein
STRINGORGLA09G0142900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044